PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp_un0752_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 417aa    MW: 47556.1 Da    PI: 9.2805
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp_un0752_001genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.68.1e-178713399
                   -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE-S CS
             B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfrk 99
                   + +++ +d++g +W++k+i+r++++r+++t+GW+ F k +gL +gD++vF   ++ ++    v+++r+
  Tp_un0752_001  8 P-EIVAKDLHGYEWRFKHIFRGTPRRHLFTTGWNAFMKTKGLTVGDSFVFITGQNgES---GVGIRRA 71
                   3.8999*********************************************6555444...5888885 PP

2Auxin_resp81.81.5e-2796175183
     Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                    a++a++tk++F v+Y+ r  +s+F+v+++++++a+++k+ +G++f m fe +++s++r+sGt++g++d  +++W+nS+WrsL+
  Tp_un0752_001  96 ASNAINTKCMFIVFYKLR--SSQFIVSCDRFVNAVNNKFNIGSKFTMCFEDNNFSKIRYSGTIIGIQD-FSIHWKNSEWRSLE 175
                    6799***********988..59**********************************************.667*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010190.0038172IPR003340B3 DNA binding domain
PROSITE profilePS5086312.069172IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-16375IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-20584IPR015300DNA-binding pseudobarrel domain
PfamPF023621.1E-14671IPR003340B3 DNA binding domain
CDDcd100173.81E-11970No hitNo description
PfamPF065071.6E-2496174IPR010525Auxin response factor
PfamPF023092.9E-5341388IPR033389AUX/IAA domain
PROSITE profilePS5174518.343352417IPR000270PB1 domain
SuperFamilySSF542773.34E-7355417No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MSHPTPTPEI VAKDLHGYEW RFKHIFRGTP RRHLFTTGWN AFMKTKGLTV GDSFVFITGQ  60
NGESGVGIRR AARERDNISS SVISTQSMYH GLIADASNAI NTKCMFIVFY KLRSSQFIVS  120
CDRFVNAVNN KFNIGSKFTM CFEDNNFSKI RYSGTIIGIQ DFSIHWKNSE WRSLEVQWDE  180
TASIPRPNKV SPWEIQHLPP SLNVPDISFL NNKCLKHVHE IGANWWIPKL NQCQEIGQSS  240
INASMSAPQL SYHHATNDLK IPSDLLMSNS VPTMSRLSYN DQIVLSTKEK IITNATTSCR  300
IFGVDMIIPK VRTINAYPKS KFFKISKEKG FHQTQTSISP NEVQNKQINF PRRLTKVQKQ  360
GVSITRSVDL SSYDGYSQLI DELEKLFDLK DELHTQNQWK IVFTDSEGDM MLVGDDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-661198155355Auxin response factor 1
4ldw_A1e-661198155355Auxin response factor 1
4ldw_B1e-661198155355Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396992.11e-172hypothetical protein EUTSA_v10029379mg
SwissprotQ9C8N71e-157ARFV_ARATH; Auxin response factor 22
TrEMBLV4KKN91e-172V4KKN9_EUTSA; Auxin response factor
STRINGAT1G34390.11e-154(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34390.11e-148auxin response factor 22